SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427720156|ref|YP_007068150.1| from Calothrix sp. PCC 7507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427720156|ref|YP_007068150.1|
Domain Number 1 Region: 189-355
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 2.49e-44
Family HI0933 insert domain-like 0.00074
Further Details:      
 
Domain Number 2 Region: 6-189,352-409
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.93e-42
Family HI0933 N-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427720156|ref|YP_007068150.1|
Sequence length 414
Comment hypothetical protein Cal7507_4965 [Calothrix sp. PCC 7507]
Sequence
MKLLSLRIVVVGGGAAGFFGAIACAKANPHAHVTLLEASRHPLAKVLISGGGRCNVTHAC
FEADRLVQNYPRGGKALLGAFTRFQAQDTVAWFATRGVHLKTEADGRMFPITNNSETIVE
CLIKAAATAGIELRLGTPVSSVKQPAKNQFELVLKSGETLKCDRLLLATGNSLGGYKIAQ
EFGHHIEPPVPSLFTFNIVDEKLRALAGVSVDPVQLRLSIDGKPQLEQTGPLLITHWGMS
GPAVLKLSAWGARVLHDSHYQTTLLINWLPHLQQEQVRQKILDVKAEWGKRPIALHRGVD
LPHRLWQYIITRIDITADDRWAEISNKKLNQLVRELTQGEYAITGKGVFKEEFVTCGGVN
LKEVNFKTMESRLVPGLYFAGEILDIDGITGGFNFQSAWTTAYLAGNAMGSSEQ
Download sequence
Identical sequences K9PQS8
gi|427720156|ref|YP_007068150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]