SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15893128|ref|NP_360842.1| from Rickettsia conorii str. Malish 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15893128|ref|NP_360842.1|
Domain Number 1 Region: 99-301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.93e-48
Family Nitrogenase iron protein-like 0.00000356
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 7.2e-17
Family Domain of the SRP/SRP receptor G-proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15893128|ref|NP_360842.1|
Sequence length 303
Comment cell division protein ftsY [Rickettsia conorii str. Malish 7]
Sequence
MISIFSKLKQSLSKTSNKISEGIDKIFYKKKLDAGTLEELEELLISSDMSVLVVTNIIEE
FKKVKFDKEIDSDTVKEALAKLIEQQLSKSAIPFTLSENKLNVILVCGVNGAGKTTTIGK
LASMYSAQGKKVAVAACDTFRAAAVNQLSTWADRANALLITGEESADPASVAYRGMEESI
KQNIDILFIDTAGRLHNKKNLMDELSKIVKVIKKLDENAPTHSVLVIDAITGQNTYNQVE
HFNDATNLTGLIVTKLDGSAKAGVIVGVVQKFNLPLYFIGIGEKIEDLKIFNQHDFARNL
VGL
Download sequence
Identical sequences Q92GB8
gi|15893128|ref|NP_360842.1| 272944.RC1205 WP_010977770.1.23845 WP_010977770.1.33163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]