SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|39933509|ref|NP_945785.1| from Rhodopseudomonas palustris CGA009

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|39933509|ref|NP_945785.1|
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.4e-53
Family Ribonuclease PH domain 1-like 0.0000163
Further Details:      
 
Domain Number 2 Region: 294-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.95e-48
Family Ribonuclease PH domain 1-like 0.00001
Further Details:      
 
Domain Number 3 Region: 145-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.75e-28
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.45e-26
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 555-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.43e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 621-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.24e-21
Family Cold shock DNA-binding domain-like 0.00062
Further Details:      
 
Domain Number 7 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.6e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|39933509|ref|NP_945785.1|
Sequence length 722
Comment polynucleotide phosphorylase [Rhodopseudomonas palustris CGA009]
Sequence
MFNIHSVEIDWGGRPLKLETGKVARQADGAVVATYGETVVLATVVAAKAPREGVDFLPLT
VDYQEKAYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPLFADGWRNETQVIVTVLSH
DMENDPDVLAMVAASAALTLSGVPFKGPIGAARVGFINDEYVLNPVLDEMAETQLELVVA
GTADAVLMVESEAKELSEEIMLGAVMFGHRHFQPVIDAIIDLAEKAAKEPRELTVVDDSE
IEKEMLGLVEQELRAAYAIPVKQDRYAAVGKVKEKAIAHFFPEGQEPKYDKLRIAGVFKE
LEAKIVRWNILDTGKRIDGRDSKTVRNILAQVGVLPRTHGSALFTRGETQAMVVTTLGTG
EDEQYVDSLSGTYKETFLLHYNFPPYSVGETGRLGGTKRREIGHGKLAWRAIHPVLPPHH
EFPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPLKRPTAGIAMGLILEGERFAVLS
DILGDEDHLGDMDFKVAGTEAGITSLQMDIKIAGITEEIMKVALGQAKDGRIHILGEMSK
ALDRARAELGEHAPRIETFKIPTDKIREVIGTGGKVIREIVEKTGAKVNIEDDGTVKVAS
SDGESIKAAIKWIKSIASDPEVGEIYEGTVVKVMEFGAFVNFFGAKDGLVHISQLAAGRV
QKTSDVVKEGDKVKVKLLGFDDRGKTRLSMKVVDQTTGEDLEAKQKAEAKAEGEAPAQAA
GE
Download sequence
Identical sequences Q6NCN8
gi|39933509|ref|NP_945785.1| 258594.RPA0432 WP_011156000.1.60452 WP_011156000.1.81860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]