SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|103348|fgenesh5_pg.C_scaffold_1000981 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|103348|fgenesh5_pg.C_scaffold_1000981
Domain Number 1 Region: 92-184
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-23
Family Cold shock DNA-binding domain-like 0.0000986
Further Details:      
 
Domain Number 2 Region: 186-308
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.66e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0076
Further Details:      
 
Domain Number 3 Region: 42-92
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000366
Family ECR1 N-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|103348|fgenesh5_pg.C_scaffold_1000981
Sequence length 332
Sequence
MPITILNPQPSTPAPRRPRAMDIDMDVASDSDSDSEMGGAAILTPGTVITSNPQWMRGHG
TYVPPNTTNITSSLAGTLTRTNKLLSVRPLRARYNPEIGDLVVGRIVEVQAKRWRVDVAA
AQLAILQISAINLPGGILRKRTETDELQIRSFFAEGDLLVAEVQQLHQDGAASLHTRSLK
YGKLRNGVFVAVGGTGGGAGVVRSKRQLWTMETANGGGKIDVLLGVNGYIWISKHVESDV
AAEAAGINRMEESVSSQIYSSQNNHIDVPTMREIARCRSVILALVENGVKVDEDTVTRGY
LEAVEFGRESADDDIYLGGERGKRLAAALSGR
Download sequence
Identical sequences A0A024S4D5 G0R7T4
51453.JGI103348 jgi|Trire2|103348|fgenesh5_pg.C_scaffold_1000981 XP_006961477.1.9351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]