SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|104293|fgenesh5_pg.C_scaffold_3000248 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|104293|fgenesh5_pg.C_scaffold_3000248
Domain Number 1 Region: 29-95
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 6.02e-27
Family Hydrophobin II, HfbII 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|104293|fgenesh5_pg.C_scaffold_3000248
Sequence length 96
Sequence
MKSFATVALFIAGILAAPQPNMKLPRSPVCSGLTSTPQCCATDVLGVADLDCQTPSSPVP
DAQTFEAVCAAGGQRARCCAIPVAGQDLLCQTPAGI
Download sequence
Identical sequences A0A024SJT4 G0RBZ9
XP_006962683.1.9351 51453.JGI104293 jgi|Trire2|104293|fgenesh5_pg.C_scaffold_3000248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]