SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|110487|fgenesh5_pg.C_scaffold_20000146 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|110487|fgenesh5_pg.C_scaffold_20000146
Domain Number 1 Region: 399-468
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.47e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00077
Further Details:      
 
Domain Number 2 Region: 291-360
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.89e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00096
Further Details:      
 
Domain Number 3 Region: 191-262
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000143
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|110487|fgenesh5_pg.C_scaffold_20000146
Sequence length 559
Sequence
MAEPAHPDIQSILAALASQRPPSSTSTQTPPAPAGAYPAPPGTAQPAPYQPPPPGVAGFA
PGSALPAPASSGNVDLSALRPVNTGTMNFEEVISKARAFATEKGITPYDRPLVYGNESRP
SDRSFRRSRSRSPPRGGGDYHTGGSYRDDRRGGQGREYGRDRSYSPPSRGRTFSPRGGGG
RERSPLRGGDDNAETIQIESSLVGLIIGRQGENLRRIEADTNCRVQFLAATDGGPFRQCK
ITGPRARRAEVKTAINRIIEDSGMGALNRAQEKPRDPARGGAAALRDGEDHMQIMVPDRT
VGLIIGRGGETIRDLQERSGCHINIVGESKSVNGLRPVNLIGSREAAARAKDFIMEIVDS
DSRGDGPASGTKKPAGPPRNDGPSRDYGGGGGPDKINDAIYVPSDAVGMIIGKGGETIRE
MQNSTGCKINVAQSSGPGEVQREIALIGTRDSIARAKQAIDEKVEAVRQKSGGGPPGGRG
RGPHDDRPSYSHQGPDPSTNQPPQASAGEGQDPYAQYGGYQNYVALWYQSLMYQQQQQGA
QGAPTSQNPTGGAPPPGGQ
Download sequence
Identical sequences A0A024S1V0 G0RS53
XP_006968028.1.9351 51453.JGI110487 jgi|Trire2|110487|fgenesh5_pg.C_scaffold_20000146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]