SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|119989|estExt_fgenesh5_pg.C_20004 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|119989|estExt_fgenesh5_pg.C_20004
Domain Number 1 Region: 17-84
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 4.97e-25
Family Hydrophobin II, HfbII 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|119989|estExt_fgenesh5_pg.C_20004
Sequence length 86
Sequence
MQFFAVALFATSALAAVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCAS
KGSKPLCCVAPVADQALLCQKAIGTF
Download sequence
Identical sequences A0A024RUV7 G0RAF8 P79073
51453.JGI119989 jgi|Trire2|119989|estExt_fgenesh5_pg.C_20004 XP_006962048.1.9351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]