SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|123967|estExt_fgenesh5_pg.C_290049 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|123967|estExt_fgenesh5_pg.C_290049
Domain Number 1 Region: 33-99
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 7.98e-23
Family Hydrophobin II, HfbII 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|123967|estExt_fgenesh5_pg.C_290049
Sequence length 102
Sequence
MQFLAVAALLFTTALAAPSSDVNGIIRRANAFCPEGLLYTNPLCCDLDVLGVADVDCVVP
PAKPSSCKSFGSVCASIGRKPRCCAVPVAGVALLCTDPIPAI
Download sequence
Identical sequences A0A024RXA3 G0RVE5
XP_006969202.1.9351 jgi|Trire2|123967|estExt_fgenesh5_pg.C_290049 51453.JGI123967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]