SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|22331|estExt_fgenesh1_pm.C_90109 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|22331|estExt_fgenesh1_pm.C_90109
Domain Number 1 Region: 109-331
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.81e-19
Family Phospholipase D 0.095
Further Details:      
 
Domain Number 2 Region: 427-608
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.38e-19
Family Nuclease 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|22331|estExt_fgenesh1_pm.C_90109
Sequence length 659
Sequence
MVSDHVLRLCHSPNTVSSLLAKNPSQSPGQIAKDLYGIYEKDLRRTPPPPSSSASASAST
SSSSSPSSRCSSSSSGNSNSNNTNNNTNINTNNNTNNNNNTNNNTNTLDLALQCGRWGPT
TPSPLFLKAFADALRCLDADPLAGVVSPPLMGSHGTVPLTVIAPLADVIRHVSNVIARAE
REVFFITCNWSPSVAQRLVRNALVELSRRAGERRQRVVVKIMYDKATAASAIDPHQRVSP
AAYSGKAIQLPAPDEVPHLDMEVVSLHKLVLGTLHAKFCVVDRKIALVMSNNMEDNCNME
MLTHLEGPIVDSIYDTALITWKRPLDPPLPSGGAGADQQRIAASGEQQSHGTAEELKEHT
PEDPHYDADLAGEIVRMQACYSTKPDETRLQAANRLLNYAVKNPVAPTGPEIPDGHEMTP
YIDTSTPYPVPMALVSRPPYGSVDSKNAFVPQNEAWLSLIRNATRDIFIQTPDLNAAPLM
PALAEALKRGVEVTYYVCFGYNDAGEVIPGQGGTNEQAARSLLSLLPEDGPERKLLRIYD
YVGKDQDRPIHQCFRARCCHVKLLIVDGCVGVQGSGNQDTQSWFHSQEMNIMVDSAEICA
KWREGIERNQNTRLYGRVAADGVWRDEKGQPGEGYMGDPGSVEGLIKGVWGMYKKMERA
Download sequence
Identical sequences G0RJP3
XP_006965232.1.9351 51453.JGI22331 jgi|Trire2|22331|estExt_fgenesh1_pm.C_90109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]