SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|3600|fgenesh1_pm.C_scaffold_7000178 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|3600|fgenesh1_pm.C_scaffold_7000178
Domain Number 1 Region: 14-182
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 9.87e-26
Family Phospholipase D 0.041
Further Details:      
 
Domain Number 2 Region: 374-442
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000576
Family Nuclease 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|3600|fgenesh1_pm.C_scaffold_7000178
Sequence length 472
Sequence
MVSELDRMAPSFDVRGDQIRILRTPAEFYETLKDRIRHAKKRIFLSTLYIGKSEKELIQT
LREALAQNPELKVSILTDALRGTRESPEASCASLLAPLVDEFGADRVEIRMYHTPNLTGL
RKQYVPKRINEGWGLQHMKLYGVDDEIIMSGANLSSDYFTNRQDRYHLFSSKEVTDYFRS
IYDGVASFSFLVEPSKEDAAGYTLSWPATNSAPSPLEKPQAFVKRTTSALQGLIAAPEKQ
PGSELKDTRVYMLTQMSQVLRPDTSTELPVLTRILERLSRPEYAGSSWTFTAGYFNPAPS
LTKLLLETASSNNVVITAAPEANGFYKSKGVSGLLPDAYVLLARRFLYAVQQRGREGDIT
LKEWRFGTAGQPGGWTYHAKGLWITMPGDANPCMSIIGSSNYTKRSYSLDLEAGALIVTR
NEALKARLGEEQNWLQDHAAKVTMDDFTRNERRVSLKVRIAMWIVKMVGGAL
Download sequence
Identical sequences G0RGW7
XP_006964390.1.9351 jgi|Trire2|3600|fgenesh1_pm.C_scaffold_7000178 51453.JGI3600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]