SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|74624|estExt_GeneWisePlus.C_20165 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|74624|estExt_GeneWisePlus.C_20165
Domain Number 1 Region: 550-594
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000482
Family Eukaryotic type KH-domain (KH-domain type I) 0.006
Further Details:      
 
Domain Number 2 Region: 256-344
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.006
Further Details:      
 
Domain Number 3 Region: 619-705
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000115
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Weak hits

Sequence:  jgi|Trire2|74624|estExt_GeneWisePlus.C_20165
Domain Number - Region: 483-530
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000545
Family Eukaryotic type KH-domain (KH-domain type I) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|74624|estExt_GeneWisePlus.C_20165
Sequence length 974
Sequence
MNKLANMRHWSERMSPNFGMGRPSVPMNSLSKNVSQPGLPLTSPAPDATIHYSFNIPFAS
DLVGPNTEDILHATTDAVLRWTHPEDAPDDVQVHELPVHAQNLANLRALCADISSGPLPI
EAQVLVSSPKNGKSQQITTVCLTGTPELVNKSRETILNEIPISMRCTTIDVEGSLVCDLS
AGVLKKPVLETLDSISSYCGVDIFLLGPKLTPVVDGMLGDSEMRMDQRWRVAIYGDLLSS
EHAKARVLIQIDSWLGRVVDVTKIELPFQQVVCGRHRKNIKLIESSTGTAIYFPPMFSQM
YRYCPPKANRRDPSDIYITGETPQAIEMAKQKLHDTVSRIRLFCKDVNIPPAKLDNILLG
RLDKVRKILEANATYIMLPPLACQRSVVRVHGTEGLPVERTVRELMSLAGQFYGAGWYVQ
QPDPRNLPAPHEIHPMLADICANSDAEVSFDKASFSVTGSDDSVKSALATISQLKFATLS
QYQIRVKIELANEHKEFVSGKKNGKINKIMGQSNVQIIFDGFNEYNFNIDVMAASYDSMK
QGLTLVEQEMPASISFHVPDQYHKRIIGIGGQHIQRIMKKHSVFVKFSNAMDRGGMGRED
DDIKVDNVICRTPARNAQNLDAVKNEILEMVDRADSEYTSQIVNVDRLYHRELIARLSEI
DELEQKYNCKINFPSTEQASDEVTVTGPQWQVPHCVDEFLGMVPDKHELVLARNAKLIKF
LESPEFAHDLVPKLKSQYEVEVTVHQNPDETTEDGSPTATLVWGFTRNNAGGLRDAIDFL
LAQFATANVETDIVKGSIPRPKSDSFEDTLQYFDSKLLQHAPASAAGDSPIKNAFNADIA
RERSSILDRLRRPGSMTSISSFLDRRKNSSHSATSSFFKGSANVSKSSLISIESTRSFNA
DRNPWNDSGVNLADDENPWARPVSNHHFDSKLSIPHPKDMMASRHATRASGDSGRPSTSH
SMNSGYPGPIGPFR
Download sequence
Identical sequences A0A024S072 G0RAP3
jgi|Trire2|74624|estExt_GeneWisePlus.C_20165 51453.JGI74624 XP_006962296.1.9351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]