SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|75534|estExt_GeneWisePlus.C_30868 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|75534|estExt_GeneWisePlus.C_30868
Domain Number 1 Region: 391-471
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.38e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.00036
Further Details:      
 
Domain Number 2 Region: 199-274
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 3 Region: 113-189
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000237
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|75534|estExt_GeneWisePlus.C_30868
Sequence length 475
Sequence
MSTSPPQPTQSAKRPLEEPSSPSRATDQPEAKRPALDKTSKSDEETEKLDLPPELPVESE
EEQNGEDNANANGVAGTESSVTATETGTDVKATPTVAISTASSSAVAASAAAHDESSWIH
IRAVISSPEAATIIGKGGENVSNIRKMSNAKCTVSDYQKGAVERILTVSGIVDAVAKAFG
LIIRTLNNEPLTEASTASSKTYPLRLLIPHILIGSIIGKGGSRIREIQEASGARLNASDS
CLPMSSERSLVVMGVADAVHIATYYVGSTLLEQLNERFGGPAASAYATRSGAPVGSIPGG
MQVVPYSPQPASGHYGRAENYGRHQERRPHHMPPAPYPQPYAHGAPHGTPAMPMQYGAGQ
PAAYGAAAPHVQPHMAPHTGPQAHGAPQGQPMHAGMPGGPITQQIYIPNDMVGAIIGKGG
QKINEIRQMSGSVIKINEPQDNSNERLVTITGTEECNRMALYMLYSRLESEKHRV
Download sequence
Identical sequences A0A024SIZ4 G0RCN0
jgi|Trire2|75534|estExt_GeneWisePlus.C_30868 XP_006962779.1.9351 51453.JGI75534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]