SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|76833|estExt_GeneWisePlus.C_60434 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|76833|estExt_GeneWisePlus.C_60434
Domain Number 1 Region: 121-224
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.82e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 
Weak hits

Sequence:  jgi|Trire2|76833|estExt_GeneWisePlus.C_60434
Domain Number - Region: 76-133
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.00432
Family Gametocyte protein Pfg27 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|76833|estExt_GeneWisePlus.C_60434
Sequence length 320
Sequence
MPSTHKKDKPWDTDDIDKWKIETFTAKDNAGGTFAEESSFVTLFPKYREVYLKEVWPLIT
KALEKHGIACTLDLVEGSMTVKTTRKTFDPAAILNARDLIKLLARSVPAPQAVKILDDGV
ACDIIKIRNLVRNKERFVKRRQRILGPNGSTLKALELLTETYILVHGNTVSAMGPYKGLK
ELRRVVEDCMNNIHPIYHIKELMIKRELAKDPELANESWDRFLPNFKKKTLSKRRVPLKV
TDKTKKVYTPFPPAPEKSKVDKQIESGEYFLSKEAKDRAALSDRKEKQKQAKDDRAKERA
AQFVPPEEDRPKKKRKKSSE
Download sequence
Identical sequences A0A024SEF4 G0RG86
XP_006964321.1.9351 jgi|Trire2|76833|estExt_GeneWisePlus.C_60434 51453.JGI76833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]