SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|78611|estExt_GeneWisePlus.C_110146 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|78611|estExt_GeneWisePlus.C_110146
Domain Number 1 Region: 22-226,271-317
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.92e-40
Family Phospholipase D 0.043
Further Details:      
 
Domain Number 2 Region: 356-502,610-704
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.26e-25
Family Nuclease 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|78611|estExt_GeneWisePlus.C_110146
Sequence length 829
Sequence
MDSLRGKLHESKLHDAKAAVSHKKHQIGKFGNLFNREHRHDEEHERRCDRKRTKICASHR
FQSYFPEREGNLVKWYVDGRDYFWAVSVALEEAKETIYIADWWLSPELFLRRPPHQKQEY
RLDQVLKRKAEQGVKIFVIVYKEVEAALTCNSEHTKHALQALCPEGSPGYNNIQIMRHPD
HNVFENAADMTMYWAHHEKFVVIDYAMAFIGGLDLCFGRWDTRCHALSDVHPDEPHAEIW
PGQDFNNNRVLDFKKVQDWQDNELSKADYGRMPWHDVSMGVIGPCVYDIAEHFVLRWNFV
KRDKYKRDERFDWIILEGREGEDEDLIGVQRPKYPMGDYIRHPLTPLSTKNLLGRGTVHA
QVVRSSADWSSGILTDRSIQNAYSEVISKAQHYVYIENQFFITATGEHQSPIHNTIGEAI
VEAVVRAGKEGRKFRVIVIIPAVPGFAGDLRDKAASGTRAIMDYQYKSICRGEHSIFERV
KAQGVDPTKHIFFFNLRSYDRLNKTPAIAEAEKKTGIGYQQVQRVLAEDIMGEGIHGTAD
PIEKERDLHMGKANEQEKARNEAVQAKEAFEKAKPKEEVQTSPSVAHHAMAGQGALEDEP
WTDPDSEIKNWIQEELYVHAKVLIADDRVVICGSSNLNDRSQQGSHDSELSIVMEDTNLV
QTTMDGKPFEAGYHAMTLRRFLWREHLGLLPPQDNDAEGDINAQPPSVEPKNDVYDNDES
WKLVEDPLGEELWEMWTSRADKNTELFRHLFHADPDDHIKTFEDYDRYLPPRGVKPGHIF
DQFMPPDEAKKKLAQIKGHLVWMPMDFLKDAEMAERGLQVNSWTESVYT
Download sequence
Identical sequences A0A024S9J7 G0RLF5
jgi|Trire2|78611|estExt_GeneWisePlus.C_110146 51453.JGI78611 XP_006966096.1.9351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]