SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|79019|estExt_GeneWisePlus.C_120263 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|79019|estExt_GeneWisePlus.C_120263
Domain Number 1 Region: 606-792,850-896
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.07e-39
Family Phospholipase D 0.047
Further Details:      
 
Domain Number 2 Region: 900-1108
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.83e-27
Family Polyphosphate kinase C-terminal domain 0.061
Further Details:      
 
Weak hits

Sequence:  jgi|Trire2|79019|estExt_GeneWisePlus.C_120263
Domain Number - Region: 291-367,454-490
Classification Level Classification E-value
Superfamily PX domain 0.0523
Family PX domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|79019|estExt_GeneWisePlus.C_120263
Sequence length 1635
Sequence
MEEPDTPTRSRTRFMSKIKAFAASGPQTPKSLNGPTFSSEFGSLSIPNSPTVSRVTTRAP
DGLNGEQSDADADVETADEAAIPAAAKKNKRKSRRFKKHSMSGFPNPSRFPSDLDAISTY
DRLLRRRASMPDTTQHDHAVSDGEIRGNPRRKPFRRGHSYMSNAMSPPGEDDMEEMENSA
VVGRRNGHLRRITVFGGGGLSDGDALTPKRHFFKTDRASSYGAQKWKQVKSTLKLLRQKK
EDRFEYYKSAELMAELRAGAPAVLMLASMIQRDEHGNKRIPVLLEQLKLKIKDSKPMPDD
DKERHWIFTIELEYGSGPSRMNWCVIRTIRDIYNLHFRYKFALNNDKYMLGKDLGGRPKQ
PKFPYSAFPYLRGARNKGDESDEDEQASGRGDETGAEMTAAEDAGEGPHSHSRKKSRSNF
LGMRRRSTGFTDGGELSVAEGNQGVDTQTRRQRYVEKQRRILEKYLSEMIHWLMFRADSN
RLCRFLELSALGVRLAAEGSYHGKEGYLHLQMSKGLDFRHVLTPAKVISRQSRKWFLVRQ
SYIVCVESPENMNIYDVYLVDTKFSIVSKKKALKRFGSKNKDKNAEDDLNMEPSHEKHHT
LKMRTSDRKIRLFSRYQSVMRQFEDSINEMLKQTVWYEKKRFDSFAPVRTGVFAQWLVDG
RDYMWNVSRAINMARDVIYIHDWWLSPELYMRRPACISQKWRLDRLLQKKAREGVKVFVI
IYRNVEAAVPIDSEYTKFSLLNLHPNIFVQRSPNQFKKNQFFFAHHEKICIVDHDVAFLG
GIDLCFGRWDSPQHPIVDDKPTGFEPSEMPKDAEHVQLFPGKDYSNPRVQDFFNLNEPYE
EMYDRGKVPRMPWHDISMQVVGQPARDLTRHFVQRWNYLRRGRKPTRPLPFLLPPPDAKF
EDLEALGLTGTCEVQMLRSASNWSLGINETEHSIQTAYVHLIEESDHFVYMENQFFITST
EAYGTRIINRIGDALVDRIIRAHQNNEDWRAVILIPLMPGFQNTVDEQEGTSVRLIIMCQ
YRSICRGEHSIFGRLRAAGIEPEDYISFYSLRQWGMMANDVLVTEQLYIHAKTIIVDDRV
ALIGSANINERSLLGSRDSEVAAIVRDTDMISSTMAGKPYKVGRFAHTLRMRLMREHLGL
DVDEILEQEREEEEMNESAYERDMDAIYEEGAAAADDNSSISSNEAKSPVLPPNNLRLPS
FNHDIDLVKLETTSSSSASSVKGKEAETDPRVMNEGHQLDVSGYGPDHWKSAEEAGVDDR
LDTVVVDGREMLLHGGKGLAESHQPRQHTAHHEPSDKSGIPPAPLPPASRDGADRADQLG
LNPGAPAVPLPVLDDTNIGGPAAHVDPKTGRPTNEPFHPMAADIQPAVINKDCMRDPLDS
TFVDEVWNRAARNNTLLYRRVFRCMPDSKVGTWAEYREYMDYNAKFKAMMEGNCAGNENE
LRREASRQQGAAGDEAVPKQGDQPTIQLPEDEEEEETEKPASGSSNGADPVLRPPPVDGS
TDNQSSLEPPSPVYTAGEVPFPALDSSPSKPVSRSKSKDRRANFSTLEKPTSKDTNAAPP
PTPSGSAPVKRRRRATTKGSRRGLLIEEMPTRNEAEQLLGLIQGHLVEFPYDWLLTEEHN
GNWGYQVDGVAPIAI
Download sequence
Identical sequences G0RMI7
XP_006966299.1.9351 51453.JGI79019 jgi|Trire2|79019|estExt_GeneWisePlus.C_120263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]