SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|82074|estExt_GeneWisePlus.C_300098 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|82074|estExt_GeneWisePlus.C_300098
Domain Number 1 Region: 54-233
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.97e-16
Family Nuclease 0.081
Further Details:      
 
Domain Number 2 Region: 271-340
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000000973
Family Nuclease 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|82074|estExt_GeneWisePlus.C_300098
Sequence length 386
Sequence
MSQPLAFPESFVKPWRDLLLSNQEQRSGDSPSYNTPEAIDSLMTTSTPKLLYVGTGHTIF
TRAILPAIASAKYSVHFVTCYWAASPSLDGLRQTLVKLAEARSTSSEALPTLRISIGFSS
WGLFQKLFHTASPEGYVYPPSKWAHLGLPDEETLRKGGIEMTVKSLFFTPISVMHPKYVI
VDESKAWVPSCNVSWERWFEGCVELEGEVVDRLLSFHARVWGASKPLSTDDVELTSSSSP
MNNKQADDDGSATQCICFSGISPSPTIFLPSPHHRNPRFSFFPFFSQSNPPMTPLNAALL
TLFANARHDINIVTPNLTSWPVMDALLDALSRGVNVHVRTARNMMVIEQLVTAGTTTSWC
IRKFVKKYQALCKRSRRNDIEAQSTS
Download sequence
Identical sequences G0RVR8
jgi|Trire2|82074|estExt_GeneWisePlus.C_300098 XP_006969353.1.9351 51453.JGI82074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]