SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|21972|estExt_fgenesh1_pm.C_50210 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|21972|estExt_fgenesh1_pm.C_50210
Domain Number 1 Region: 6-74
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 1.13e-19
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|21972|estExt_fgenesh1_pm.C_50210
Sequence length 83
Sequence
MAPAQPELKKYLDKRLFVQLNGSRKVIGVLRGYDVFLNIVLDEAVEEKDGGEKIRLGMVV
IRGNSVVMLEALERIGGDDRQNR
Download sequence
Identical sequences A0A024RW81 A0A0F9WU04 A0A1T3CTT0 G0REQ9 G9MKE5
jgi|Trive1|32934|e_gw1.3.1916.1 51453.JGI21972 XP_006963552.1.9351 XP_013959334.1.71794 jgi|Triha1|439995|CE270146_10305 jgi|Trilo1|7131|gm1.7131_g jgi|Trire2|21972|estExt_fgenesh1_pm.C_50210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]