SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trire2|73895|estExt_GeneWisePlus.C_10737 from Trichoderma reesei 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trire2|73895|estExt_GeneWisePlus.C_10737
Domain Number 1 Region: 275-358
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0009
Further Details:      
 
Domain Number 2 Region: 127-212
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.78e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 3 Region: 41-114
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trire2|73895|estExt_GeneWisePlus.C_10737
Sequence length 369
Sequence
MAASQDILSPNGGDIVDSMDQLKMDERLGPDGELAPKTDEEYAQAQLTLRAIVSSKEAGV
IIGKGGKNVADLRDETGVKAGVSKVVQGVHDRVLTITGGCDAISRAYAIVARALLEGAPV
VGMGGVVQNNGTHPIKLLISHNQMGTIIGRQGLKIKHIQDVSGVRMVAQKDMLPQSTERI
VEVQGTPEGIQRAIWEISKCLVDDWQRGTGTVLYNPVVRTQSSGSGSLGGSGYGNGSGRD
YGSPRVMRTGNGADFSNGGSRPFSRRSDSDAATRGPPTHDENGEEIQTQNISIPADMVGC
IIGRGGSKISDIRKTSGARISIAKAPHDETGERMFTIMGTAKANESALFLLYENLEAEKM
RRSQMQDQE
Download sequence
Identical sequences A0A024SK78 G0R813
XP_006961655.1.9351 jgi|Trire2|73895|estExt_GeneWisePlus.C_10737 51453.JGI73895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]