SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90421727|ref|YP_530097.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90421727|ref|YP_530097.1|
Domain Number 1 Region: 28-249
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.47e-73
Family Atu2684-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90421727|ref|YP_530097.1|
Sequence length 251
Comment hypothetical protein RPC_0203 [Rhodopseudomonas palustris BisB18]
Sequence
MMAWSGLLNGPGALAACALLATICPAVAQPRAVVELFTSQGCSSCPAADKIIGDLASDPS
VIALSMPIDYWDYLGWKDTLADSRFSARQKAYSARRGDRDVYTPQMIVNGAMQVVGNDRA
RIDGAISDTEKTAGVMSVPVTVTLDGKQLKVAVAAGAADVAPSQAEVWICSISKAVPIAI
TRGENRGREVTYHNVVRTWLKVGDWTGQADSWTVPIENVAGAGVDAAVVYVQSGSREQPG
PMLGAALTALD
Download sequence
Identical sequences Q21CV8
316056.RPC_0203 WP_011470686.1.69038 gi|90421727|ref|YP_530097.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]