SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90423426|ref|YP_531796.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90423426|ref|YP_531796.1|
Domain Number 1 Region: 37-239
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.74e-68
Family Glutathione peroxidase-like 0.00000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90423426|ref|YP_531796.1|
Sequence length 241
Comment peroxidase [Rhodopseudomonas palustris BisB18]
Sequence
MSCTTTAIAVPAIPETPVPAAALAPAPVSAPMTSSLPRINAPAPHFAAKTTFGDRTLADY
RGRWLVLFSHPADFTPVCTTEFIAFAKAADSFKAANCDLLGLSIDSVFSHLAWVGNIKEK
FGVEIPFPIIEDLSMNVAKAYGMIHPGASDTSAVRATFIIDPDGILRAMVYYPMTNGRSV
AEILRLVQALQTSLSQGVATPEGWQPGEKIIVGPPMTVAEVATRMSEGLETVDWYFSKRA
L
Download sequence
Identical sequences Q217F9
WP_011472381.1.69038 gi|90423426|ref|YP_531796.1| 316056.RPC_1920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]