SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90424643|ref|YP_533013.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90424643|ref|YP_533013.1|
Domain Number 1 Region: 78-207
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.09e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.65e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|90424643|ref|YP_533013.1|
Sequence length 235
Comment glutathione S-transferase-like protein [Rhodopseudomonas palustris BisB18]
Sequence
MIELYYAPTPNGWKISIMLEECGLAYELHPMQLGRGDQHQPEFLKLNPNGRMPAIVDRDP
VDGGAPLTVFESGAILLYLAEKSGLFMPRDLRGRLNVTQWLMWQMGGLGPMLGQNGHFLL
YAPEKIAYAIDRYMREAKRLYGVLDTQLAAREYIAGDYSIADIACFPWIMTHKAQGLTLD
DYPNVKRWYAALRARPRLQAGLAVGKQETQPMDQQARKIMFGVDAPSHAQGQQQQ
Download sequence
Identical sequences Q212J2
WP_011473584.1.69038 gi|90424643|ref|YP_533013.1| 2005341468 316056.RPC_3152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]