SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90425620|ref|YP_533990.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|90425620|ref|YP_533990.1|
Domain Number - Region: 18-71
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0313
Family Thioredoxin-like 2Fe-2S ferredoxin 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|90425620|ref|YP_533990.1|
Sequence length 103
Comment hypothetical protein RPC_4146 [Rhodopseudomonas palustris BisB18]
Sequence
MVKTTSLVIARPRRAPPVLICRKCLSRVDDGKALKRALKSALKQRSQAQGVKRPRLVITG
CLGICPKRAVVAASAATLQRDEYLLLKEAGEAGEAAGVLMGEG
Download sequence
Identical sequences Q20YW5
WP_011474552.1.69038 316056.RPC_4146 gi|90425620|ref|YP_533990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]