SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90425915|ref|YP_534285.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90425915|ref|YP_534285.1|
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.77e-44
Family Glutathione peroxidase-like 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90425915|ref|YP_534285.1|
Sequence length 184
Comment alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodopseudomonas palustris BisB18]
Sequence
MLGIGDHLPSFEVVGVKPGFHVQEENGQSAFETLTETSFPGKWKVIFFYPKDFTFVCPTE
IAEFARLSKDFADRDAVVLGGSTDNEFCKLAWRRDHKDLHKLAIWQFGDSKGSLVDGLGV
RSPDGVAYRYTFIVDPDNVIQHVYGNNLNVGRSPKDTLRVLDALQTDELCPCNREVGGET
LKVA
Download sequence
Identical sequences Q20Y20
WP_011474846.1.69038 316056.RPC_4443 gi|90425915|ref|YP_534285.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]