SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90426117|ref|YP_534487.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90426117|ref|YP_534487.1|
Domain Number 1 Region: 96-336
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 8.5e-88
Family Nqo1 FMN-binding domain-like 0.000000721
Further Details:      
 
Domain Number 2 Region: 422-507
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 5.1e-29
Family Nqo1C-terminal domain-like 0.0013
Further Details:      
 
Domain Number 3 Region: 337-420
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 6.15e-20
Family Nqo1 middle domain-like 0.001
Further Details:      
 
Domain Number 4 Region: 1-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000537
Family Thioredoxin-like 2Fe-2S ferredoxin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90426117|ref|YP_534487.1|
Sequence length 518
Comment NADH dehydrogenase (quinone) [Rhodopseudomonas palustris BisB18]
Sequence
MKLKIFIPRDAGAIAVGADEVALELELCARKRGVSLEVVRTGSRGLYWLEPMLEVSTGAG
RIAFGPLTPGDVGSVLDAIAADGPHPLRLGLTEQIPWLKRQTRLTFARCGVIDPRSVEDY
RAHGGYEGLERALALTSEAIIDDVIKSGLRGRGGAGFPTGIKWRTVAQAAAAQKYICCNA
DEGDSGTFADRMIMEGDPYMVIEGMTIAGIAVGATRGYIYIRSEYPHAVEAINAAIAGAR
RAGYLGPGIGRSRHDFDIEVRVGAGAYICGEETAMLESIEGKRGVVRAKPPLPAHKGLFG
QPTVINNVLSFAAIPFILAGGAQAYADCGMGRSRGTKPIQLGGNIKHGGLFEVAFGITLG
ELVDDIGGGTASGRPVRAVQVGGPLGAYFPRELFDTPFDYEAFAARSGLVGHGGVVVFDD
TVDMAKQARFAMQFCAIESCGKCTPCRIGSQRGVETIDKIINGDRAPQNIALLEDLCQTM
KLGSLCALGGFVPYPVLSALTHFPEDFGLAPPRLQAAE
Download sequence
Identical sequences Q20XG8
316056.RPC_4646 WP_011475045.1.69038 gi|90426117|ref|YP_534487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]