SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90426378|ref|YP_534748.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90426378|ref|YP_534748.1|
Domain Number 1 Region: 32-134
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 2.62e-28
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.00027
Further Details:      
 
Domain Number 2 Region: 486-598
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.6e-21
Family Thioltransferase 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|90426378|ref|YP_534748.1|
Sequence length 602
Comment cytochrome c biogenesis protein, transmembrane region [Rhodopseudomonas palustris BisB18]
Sequence
MAVRLFRMLILLVAIVAGGATVHAGPARTAPFQLNAQHGADGVELTWRIAAGDYLYRDKI
AVTTAEGGRVALQTPAGEVKDDPNFGITEVYHHSLTATIPADAVKGASRLTVSYQGCAER
GICYPPVTARVDLGTYQVSIAGGAAPSADPAWPSDVPALPELAEPAATSASMPASVLPSM
TQGWLPLLLAFAGFGLLLAFTPCVLPMVPIVAGMLTRSGPDLSPVRGFALAAIYTLAMAS
AYAALGVAAAWSGQNLQSALQAPLALAVMASIYVALALSSFGLFELQLPARFGDNLAGRL
HGRAGPLLGAAALGFTSALIVGPCVTPPLAAALLYVAQTGDTLRGAAALFALGLGMGFPL
ILVGLFGAGVLPRSGPWLVTIRKLFGFAFLGLAVALISRVLPGAVALLLWSGLAIGLAAF
LGAFDRLDRSGGAVRRFGKAAGLAVFVYGATLIIGAVGGSEDPLRPLAVFGADQPAATAI
FARTVTSIPALDQAIVDGRARGKPIMIDFSADWCTSCKTMERDVFGDPTVRRRLNDVTLI
RADVTRSNAETAALMKRFDVVGPPTVVFLDQHDGHEITSARTVGEVPADSFVQTLQRIGA
SS
Download sequence
Identical sequences Q20WQ7
WP_011475305.1.69038 gi|90426378|ref|YP_534748.1| 316056.RPC_4907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]