SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90426379|ref|YP_534749.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90426379|ref|YP_534749.1|
Domain Number 1 Region: 35-201
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.08e-35
Family DsbA-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|90426379|ref|YP_534749.1|
Sequence length 210
Comment DSBA oxidoreductase [Rhodopseudomonas palustris BisB18]
Sequence
MNRRQSLLILGALAAVPLSKVFSAPAAWAEGIDVKAILNDPDAPETGNPKGSLTIVTYFD
YNCPFCKKAEPDLEQVVRDDGKIRLVYKDWPILTEASVYGAQMALGAKYQGKYQAAHDAL
MAIPGRGISKDQMRDAVAAASVDMTRLQSDLGAHGDAITALLRRTLSQADAMGLQGTPVY
LIGPYKVAAALDAAAFKKVVDQARARPLAK
Download sequence
Identical sequences Q20WQ6
2005341373 WP_011475306.1.69038 gi|90426379|ref|YP_534749.1| 316056.RPC_4908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]