SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90421788|ref|YP_530158.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90421788|ref|YP_530158.1|
Domain Number 1 Region: 16-125
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.2e-31
Family Thioltransferase 0.0014
Further Details:      
 
Domain Number 2 Region: 140-292
Classification Level Classification E-value
Superfamily TPR-like 0.0000000111
Family Tetratricopeptide repeat (TPR) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90421788|ref|YP_530158.1|
Sequence length 305
Comment thioredoxin-like protein [Rhodopseudomonas palustris BisB18]
Sequence
MTIIEQGNGAAPQATDLIKETSTQSFVKDVIEESKRQPVLIDFWAPWCTPCRQLTPLLEK
AVRAANGKVKLVKMNIDEHPSIPGQMGIQSIPAVIAFVGGQPADGFMGAVPESQINAFID
KLTAGAGGGAPGVGELIEEAEAALAAGDAATAAAVYAEVLAVEADNLPALAGLARCYVET
GAMEQAKQTLALVPDSKREDSAVKAVQAAIDLAEQAKALGPITELEQKVAANPLDHQARF
ELAVALNAAGRRADATSQLLEIVKRDRKWDDDGARKQLVLLFEAWGPTDEATVDGRKRLS
TILFS
Download sequence
Identical sequences Q21CP7
WP_011470747.1.69038 316056.RPC_0264 gi|90421788|ref|YP_530158.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]