SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90422139|ref|YP_530509.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90422139|ref|YP_530509.1|
Domain Number 1 Region: 2-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.94e-41
Family ArsC-like 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|90422139|ref|YP_530509.1|
Sequence length 142
Comment arsenate reductase [Rhodopseudomonas palustris BisB18]
Sequence
MDVIIYHNPDCGTSRNTLALIRHAGIEPHVVEYLKTPPSRAMLQQLIARIGLGTRALLRE
KGTPYAELGLDSPALSDDELLDAMLAHPILINRPIVVSPRGVKLCRPSEEVLEILPPITA
GEFHKEDGELVIDASGRRVATA
Download sequence
Identical sequences Q21BP6
316056.RPC_0617 gi|90422139|ref|YP_530509.1| WP_011471098.1.69038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]