SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90424642|ref|YP_533012.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90424642|ref|YP_533012.1|
Domain Number 1 Region: 2-203
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.73e-43
Family DsbA-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|90424642|ref|YP_533012.1|
Sequence length 206
Comment DSBA oxidoreductase [Rhodopseudomonas palustris BisB18]
Sequence
MIEFFFDCSSPWSYLAFHNIQPLAKEFGEEIAWRPILVGGIFNSINPSVYAQRDRPVPAK
AAYMTKDLADWARAAGLAIKMPPRVFPVNSVKAMRGCLWLGRDDARAMLPFARAVFEAYW
SDDHDISQDAVLNEICQRVGVDPAALFAGIAEQSIKDQLKANTDELMARGGFGSPTIFVD
RTDMYFGNDRLPLIRDALARRRASAA
Download sequence
Identical sequences Q212J3
WP_011473583.1.69038 316056.RPC_3151 gi|90424642|ref|YP_533012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]