SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90425550|ref|YP_533920.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90425550|ref|YP_533920.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.73e-33
Family Glutathione peroxidase-like 0.0000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|90425550|ref|YP_533920.1|
Sequence length 161
Comment peroxiredoxin-like protein [Rhodopseudomonas palustris BisB18]
Sequence
MTIKVGDQLPEAKFRVMSEEGPQVKTTEDIFKGKKVAVFAVPGAYTGTCHKMHLPSIFLN
AYAIKDKGVDTIAIVSVNDAFVMGAWKRDTDLRNEATFLADGNAEFTKAIGMELDASGNG
LGIRSHRYSMLVEDGVVKTLNLEPNPGKVEVSGGDTLLEQL
Download sequence
Identical sequences Q20Z35
gi|90425550|ref|YP_533920.1| 2005341870 316056.RPC_4075 WP_011474482.1.69038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]