SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90425787|ref|YP_534157.1| from Rhodopseudomonas palustris BisB18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90425787|ref|YP_534157.1|
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.47e-29
Family ArsC-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|90425787|ref|YP_534157.1|
Sequence length 145
Comment nitrogenase-associated protein [Rhodopseudomonas palustris BisB18]
Sequence
MAKVTFYEKPGCGGNAKQKALLLASGHDVEVRNLLTQPWDAASLRPFFGEKPVADWFNAS
SPRVKSGEIRPNEIRPDVAIAMMIEDPLLIRRPLMQVGEHRQSGFDQAAVDAWIGLRPTE
TEVTDRCLKEGDAAHAAACRAAAEP
Download sequence
Identical sequences Q20YE8
gi|90425787|ref|YP_534157.1| WP_011474719.1.69038 316056.RPC_4315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]