SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428303794|ref|YP_007140619.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428303794|ref|YP_007140619.1|
Domain Number 1 Region: 28-143
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000724
Family Carbon-carbon bond hydrolase 0.09
Further Details:      
 
Weak hits

Sequence:  gi|428303794|ref|YP_007140619.1|
Domain Number - Region: 186-246
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.093
Family PG130-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428303794|ref|YP_007140619.1|
Sequence length 256
Comment hypothetical protein Cri9333_0109 [Crinalium epipsammum PCC 9333]
Sequence
MEWQEVNGNWVYIPQYHTGIVHFLGGAFVATAPHVTYRLLLEDLASKNYAIIATPFVNTF
DHTAIAKSVHQSFDRTIEQLRAKSLLRRRYLPIYGVGHSMGCKLHLLIGSLFPVERAGNI
LISFNNFAARDAVPLVEQFSGAFTVEFTPSPLETISLISQRYQVKRNLIIKFNNDNLDQS
LALRETLDKRFPGMITSQILKGSHVTPLGQDFKWQVSSVYTPFDALGQWMKQEVYRDLHQ
LKQEMLRWLNPLAINN
Download sequence
Identical sequences K9VU81
WP_015201253.1.21814 gi|428303794|ref|YP_007140619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]