SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307339|ref|YP_007144164.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307339|ref|YP_007144164.1|
Domain Number 1 Region: 249-422
Classification Level Classification E-value
Superfamily GAF domain-like 1.46e-51
Family GAF domain 0.0000728
Further Details:      
 
Domain Number 2 Region: 620-784
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-39
Family Histidine kinase 0.0005
Further Details:      
 
Domain Number 3 Region: 431-546
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.18e-22
Family Heme-binding PAS domain 0.024
Further Details:      
 
Domain Number 4 Region: 138-250
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.03e-18
Family Heme-binding PAS domain 0.04
Further Details:      
 
Domain Number 5 Region: 548-632
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.34e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|428307339|ref|YP_007144164.1|
Domain Number - Region: 3-110
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000135
Family Heme-binding PAS domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428307339|ref|YP_007144164.1|
Sequence length 801
Comment multi-sensor signal transduction histidine kinase [Crinalium epipsammum PCC 9333]
Sequence
MRLDENLKILDFSEGILPFADYPNELIIGQDARRCFPELIGAEERLNLIMQGQDLSFEVK
GICRSLEKKNRLYFDLYTNPIKTEACLEKQLIFFLEDITEKMLLQQQLKQQTNETNILIN
SVAGYRNYLNRIIAAMGDALLVTSNSGIIETINQATESLLGYSVEEISGKHISQFIKSTD
FLPQDHQLCLLSESEHLQNIESVCYTKNQEEIFVAFSCSAIKSEVEGLYNFIYVGRDITE
RKRAELELRRQNRRSQLLATIALKIRQSLQIEEILQTTVNEVRSLLQVDRVLILRVFPDG
TGSAVVTESVVSHLPSLLNRQFLPEVFPVEYHQMYRKGRIQAIEALENAQISPCHAQFLE
DLGIQSKLVVPIIYADELWGLLIAHQCNSQRIWDNFEIELLQQLANQAAITISQSQLLQA
VQESEKQFRQLTENINEVFWLFDPEKDQVLYISSAYEKLWGYHRESLYKHPQSWLDAVYQ
DDRDRVIAAVEKSHQCQDFFNQEYRIIGADGFLRWIWGREFPIHNERGEIYRIAGIAENI
TDRKQAEEEINKSLEQEKELNELKSSFISMVSHEFRTPLSTILLSSELLQNYSHKWDQTK
KNKAFKRIHSSVKTMSKLLEDVLVIGKSEAGKQEFNPVLLNPILFCEELVSEIQLTIALT
HKINFVTKGDGNNAYLDEKLLRQILNNLMTNAVKYSSPSSTVHLLCDCQEEIVVFEVRDE
GIGIPLEDQKHLFETFHRASNVGQIPGTGLGLAIVKQSVDLHQGEINIQSQVGAGTTFIV
KLPTNCQQQAEAITLAQGYAQ
Download sequence
Identical sequences K9W4D1
gi|428307339|ref|YP_007144164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]