SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 27659.m000074 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  27659.m000074
Domain Number 1 Region: 133-332
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.85e-29
Family HyaE-like 0.079
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.67e-16
Family GntR ligand-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 27659.m000074
Sequence length 537
Comment conserved hypothetical protein
Sequence
MTPRRLKPIQAAVERMRYEGAPTSDTVNADLDFHRAVAVASGNDYLAAMIRIVLEPMRPL
IAANFARQGPMFGKIPNTARAEHETLIQAFIDKDAAAARELMGRHISARASAMRRRLIRA
VHRAAPDQMRMGQRMKLIFVGDPMCSWCYGFGKEMSAIAQSMPDLDVQVVVGGMAAGSTQ
VLDDAAKQFRLTHWARVEQMSGAEFNREALMARKDFVYDTEPVCRAVVAARMVAPGVDLL
KVFRAFQRAFYVDGLDTTDGDVLAEIGAKAIAEQDIAVTADAFFEVFSSDEAIDAAQQDF
ALTRRLGVQGFPSLFVEVDGKIGRLTSGYATAGQHVEPRQQRHDGKQRRRRNGGACRCLL
DVVLDRKHVGALGRRHGGADHCREGRRSVQSDRYAQAIHDERHRNQLECREQRVAARMAA
QFVDRQVEADGEQRARRQRFTEDAEVGDGGRGQRQPADRPQQAEDRRENHRVRTDLLGER
AAAHLVRTALLIDFEQHDEGGKHDCAHKHRRDGCGEHAVLTLQRSENGQRDEARVGH
Download sequence
Identical sequences B9T977
27659.m000074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]