SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29351.m000041 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29351.m000041
Domain Number 1 Region: 83-136
Classification Level Classification E-value
Superfamily Flagellar hook protein flgE 0.000000000000366
Family Flagellar hook protein flgE 0.0064
Further Details:      
 
Weak hits

Sequence:  29351.m000041
Domain Number - Region: 37-103
Classification Level Classification E-value
Superfamily Glycerate kinase I 0.00719
Family Glycerate kinase I 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29351.m000041
Sequence length 166
Comment Flagellar basal-body rod protein flgG, putative
Sequence
MQAQQLNVETIASNLANVNTAGYKRSRVSFSDLVALDPARRTAALAGSDAGLLAPVMRMG
AGVGVAGISKLFDAGDIKKTDLPMDIIVQGEGFFEVQTPDGTPAYTRGGTWTVNRDGNLA
TSAGLALKPAIAVPDDVQALVVQPDGRVQARVAGQQSLADLGKIDL
Download sequence
Identical sequences B9TBM8
29351.m000041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]