SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31632.m000035 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31632.m000035
Domain Number 1 Region: 91-170
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.08e-17
Family GntR-like transcriptional regulators 0.015
Further Details:      
 
Domain Number 2 Region: 185-314
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000000824
Family GntR ligand-binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31632.m000035
Sequence length 343
Comment Pyruvate dehydrogenase, putative
Sequence
MNHAAVHRVARFRPVQGDGGNPVADFDDKMLVTGVARHRVSVVLAYSSDGSLVRPTDFDC
TWTLAGNGTRIVIDNRRMQKQAATTSATFEPVSTPRAFEQVCNQIRGQLASGQLKAGDKL
PPERELCVRFAVSRSVLREALRSLEIAGVITLKKGGTGGSFIAESNPRRVTQALADMMHL
GAMSLSDLTEVRSLIMADAIRLACERATDEDFAAMDANIELTEKLTLARDYEERRSVATD
FYHHVAVASRNPALVLVVDSLTGLLRQFFRTPATRPMSTLISSRRAFMKHLRARNASKAT
QELSTYLAGLHQYMAGPRNAPADVPLPPSPSGAEPARKRVKKA
Download sequence
Identical sequences B9TCQ9
31632.m000035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]