SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 34418.m000029 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  34418.m000029
Domain Number 1 Region: 86-213
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.17e-26
Family GntR ligand-binding domain-like 0.0053
Further Details:      
 
Domain Number 2 Region: 13-104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.71e-18
Family GntR-like transcriptional regulators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 34418.m000029
Sequence length 241
Comment conserved hypothetical protein
Sequence
MTLKFEKLQVRPDYVEEVYRVLADAISDGSLAPGTRLTQEEIAEQFAVSRSPVLQALRLL
KKDGLVQDAPGRGVLVAPLDVEWTSHLYQVRGALDTLAARLAAERGAVIDSALIMRGRLV
SKGKDVKAMIDADIAFHSAIYEASGNPLIVESAQLHWVHLRRVMGAVLQSSRLRDSIWDE
HQAIAEAIAARDPARAAELTELHTSSARQNLVARLGEMLKAGEGLVFSVCDAGVGFGWLG
L
Download sequence
Identical sequences B9TK67
34418.m000029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]