SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 35398.m000038 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  35398.m000038
Domain Number 1 Region: 19-111
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 7.59e-18
Family GntR ligand-binding domain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 35398.m000038
Sequence length 122
Comment conserved hypothetical protein
Sequence
MPRWHSAMIEASTIPCSMHGRDNEAWSQADLEFHTAIINASGNWVFRQFATAIRAALLAS
FRLTNRASQSHDYAIARHQDVLDAIRMRRPDAARFAMEQLIGTARMELSDALRAAQLKDG
PK
Download sequence
Identical sequences B9TGR2
35398.m000038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]