SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 40709.m000023 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  40709.m000023
Domain Number 1 Region: 92-171
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 1.96e-22
Family TonB 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 40709.m000023
Sequence length 174
Comment Protein tonB, putative
Sequence
PLAIEIASPPPPPPPPPEPPKPQPRIVKAAPVKAAPPLPVVSPQAVDNGPPTADTVQVAT
APAPAPAPVVAAPPAPPPPEPVTEARGFVGYRNNPAPDYPALAQDRGMQGRVILRVHVLA
SGKADNVTVDKSTGFKILDDAAIKAVLQWTFDPARRGQTPIDGWVTVPLNFKLS
Download sequence
Identical sequences B9TNN6
40709.m000023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]