SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 41201.m000022 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  41201.m000022
Domain Number 1 Region: 60-174
Classification Level Classification E-value
Superfamily Outer membrane phospholipase A (OMPLA) 6.8e-22
Family Outer membrane phospholipase A (OMPLA) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 41201.m000022
Sequence length 176
Comment conserved hypothetical protein
Sequence
MQDALRTCQTEFAEDASRRLVCFDKVAEQYTPTRVVPPILAPSQQELVKSVGAETGYLSR
KWHLNRQEELHFTDLETHQLNYLVTAYSNNPNDIPTSPSRPNTQDRGLGHNDLHFQISLK
TQLMNLSDWLPKNQWVQSARLWGAYTQQSYWQVYNEQQSRPMRDHNYSPELILSLG
Download sequence
Identical sequences B9THS9
41201.m000022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]