SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45487.m000014 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45487.m000014
Domain Number 1 Region: 12-194
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.25e-38
Family Histidine kinase 0.0000107
Further Details:      
 
Domain Number 2 Region: 190-231
Classification Level Classification E-value
Superfamily CheW-like 0.0000085
Family CheW-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 45487.m000014
Sequence length 235
Comment chemotaxis sensor histidine kinase/che A, putative
Sequence
MVDEVLTMRMRPFRDGVQHFPRMVRDLARSLGKDVQLQIIGEDTLVDRDILVKIESPINH
MLRNAIDHGMDSAADRITAGKPGTGTIVLEAKHRAGMLSIEISDDGKGVDLEKIRARVID
RKMAPAQMAASMSPAELMEFLFLPAFSLKDNITEISGRGVGLDIVHETIRSQNGTVRIES
ELGVGFRTSITLPLTQSIVRALVVDVKGEAYAVPIVQVERVLKVPQSGIHTLENK
Download sequence
Identical sequences B9TNZ0
45487.m000014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]