SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 46283.m000013 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  46283.m000013
Domain Number - Region: 10-82
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00259
Family GntR ligand-binding domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 46283.m000013
Sequence length 271
Comment conserved hypothetical protein
Sequence
LVDQEAAVRQARQLVEVREFVDAVLDLFAFREVRIRAGQAHRVAGAVAQDEAAAQHGDVV
AVAVAQAEFHAVRLALPGQQFVQDGDHAHAVVGMRQAHPGFRVGRVLVGRVAEHVPPARR
IIEFAGDEVPVPRCVGRPLQREAHAFLGLVQRLLRVLEDRAVHEADDDALDGAMPVALRI
GIADRPAHVAVVRTGHADDEVRHPGARAQDRVHGIFGRRHAGAVRAHEMPGGVARLRRPH
LVLAAPQQRQRMAVGGHHAPRGIVHHDTGRQ
Download sequence
Identical sequences B9TLG7
46283.m000013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]