SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 53785.m000014 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  53785.m000014
Domain Number 1 Region: 43-127
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000000000103
Family MesJ substrate recognition domain-like 0.0073
Further Details:      
 
Domain Number 2 Region: 132-270
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000144
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 53785.m000014
Sequence length 275
Comment conserved hypothetical protein
Sequence
MPVLRERYPQLDSALLRSASHLADAQLLLDTLAQQDLLQCDVREEWLGQSIAIPYLHSLG
DVRAKNLLRFWFQQRQLRMPNTEQLQDYWKQLSSVKPHRYLHLPLQGQAADHRAYLHHYQ
QRLYCVAKPAALPQTPLVWQGHQTQTWGDWQVQFKVSKGRGVALARLGISPAAITLNKRY
GQPIPLPDGLSLLITPRMGCEVLQPDAKRPRRELKVIFQMLGIPPWQRAFYPVVQVATTQ
PTASQTLVALAALAVDEAWRPGRNAYGLEIFLHPL
Download sequence
Identical sequences B9TKB8
53785.m000014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]