SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 58700.m000017 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  58700.m000017
Domain Number - Region: 55-124
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0178
Family GntR ligand-binding domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 58700.m000017
Sequence length 285
Comment conserved hypothetical protein
Sequence
MALRPDEPEIEGLLSLMLLHHARRLARIGEGGAILTLEKQDRGLWDRAVIDEGVALIERA
LKRGGPGPYQLQAAVIAVHAEARSFAETDWRQIALLYGELARTADNPVYELNRIVALSYF
EGAAVLCRTGRSAGARWPDRSGEARLCEGYRALAVGCGEAVPKATAERDRLAALRHEDLH
GEDREHAGEGIVHAAQHLPVVLQPACQPVGCEHDECVHRHADQDEEETEEQQLIGYCRVA
GGDELRQEGHEEDDDLRVQQVHPKAAGDVGKRCALGFIDLADGQL
Download sequence
Identical sequences B9TLE7
58700.m000017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]