SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 59848.m000025 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  59848.m000025
Domain Number 1 Region: 27-164
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.4e-20
Family GntR ligand-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 59848.m000025
Sequence length 177
Comment conserved hypothetical protein
Sequence
GPRVRTPSPQVAAQHVGLILQSRNVTLADVYAMRLMVEPLAVRILATNCDPAAIAALNAV
VAEEGEALEDSERFGDIEVRFHEALFRQAGNQTLGLVFELLHTIFERHMQSFITAYAPRP
DAYAQRKKTLTAQKKLVALIEAGDAQLAESFWSLHLEKAASFMLQDRELERVVDLLG
Download sequence
Identical sequences B9TMY3
59848.m000025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]