SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 30174.m008901 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  30174.m008901
Domain Number 1 Region: 608-799
Classification Level Classification E-value
Superfamily Sec7 domain 3.14e-79
Family Sec7 domain 0.00000114
Further Details:      
 
Domain Number 2 Region: 376-488,528-546,916-954,1129-1297,1331-1396,1426-1507
Classification Level Classification E-value
Superfamily ARM repeat 2.33e-16
Family Armadillo repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 30174.m008901
Sequence length 1780
Comment cytohesin 1, 2, 3, putative
Sequence
MASSEADSRLNQVVAPALEKIIKNASWRKHSKLAHECKSVLEKLTSPQKQHSPDSDPDAS
IPGPLHDGGPIEYSLAESESVLSPLINACGTGFLKIVDPAVDCIQKLIAHGYLRGEADPT
GGSPEAQLLSKLIESVCKCYDIGDDAIELSVLKTLLSAVTSISLRIHSDCLLQIVRTCYD
IYLGSKNVVNQTTAKASLIQMLVIVFRRMEADSSTVPIQPIVVAELMEPVEKSDADGSMT
MFVQGFITKIMQDIDVVLSTGGTPSKVSVGAHDGAFETTATVETTNPADLLDSTDKDMLD
AKYWEISMYKTALEGRKGELADGEVERDDDLEVQIGNKLRRDAFLVFRALCKLSMKTPPK
EASADPQLMRGKIVALELLKILLENAGAVFRTSDRFLGAIKQYLCLSLLKNSASSLMIVF
QLSCSIFISLVSRFRAGLKAEIGVFFPMIVLRVLENVAQPNFQQKMIVLRFLEKLCVDSQ
ILVDIFINYDCDVNSSNIFERMVNGLLKTAQGVPPGTTTTLLPPQEATMKLEAMKCLVAI
LKSMGDWMNKQLRIPDVHSTKKLDVADNIPEPGCLAMANGNGDEPVEGSDSHSEASTEAS
DVSTIEQRRAYKLELQEGISLFNRKPKKGIEFLINANKVGNSPEEIAAFLKNASGLNKTL
IGDYLGEREDLSLKVMHAYVDSFDFQGMEFDEAIRVFLQGFRLPGEAQKIDRIMEKFAER
YCKCNPKVFTSADTAYVLAYSVIMLNTDAHNPMVKNKMSADDFIRNNRGIDDGKDLPEEY
LRSLFERISRNEIKMKEDDLALQQKQSMNSNKILGLDGILNIVIRKRGEDRMETSEDLIK
HMQEQFKEKARKSESVYYAATDVVILRFMIEVCWAPMLAAFSVPLDQSDDEVVLALCLEG
FRCAIHVTAVMSMKTHRDAFVTSLAKFTSLHSPADIKQKNIDAIKAIVTIADEDGNYLQE
AWEHILTCVSRFEHLHLLGEGAPPDATFFAFPQNESDKSKQSKSTILPVLKKKGPGRMQY
AAAAVMRGSYDSAGIGGGASGAVTSEQMNNLVSNLNMLEQVGSSEMNRIFTRSQKLNSEA
IIDFVKALCKVSMEELRSASDPRVFSLTKIVEIAHYNMNRIRLVWSSIWHVLSDFFVNIG
CSENLSIAIFAMDSLRQLSMKFLEREELANYNFQNEFMKPFVIVMRKSSAVEIRELIIRC
VSQMVLSRVNNVKSGWKSMFMVFTTAAYDDHKNIVLLAFEIMEKIIRDYFPYITETETTT
FTDCVNCLIAFTNSRFNKDISLNAIAFLRFCATKLAEGDLGSSSRNKDKEATGKIPPSSP
QAGKEGKHDNGEIGDKEDHLYFWFPLLAGLSELSFDPRPEIRKSALQVLFDTLRNHGHLF
SLPLWERVFESVLFPIFDYVRHAIDPTGGDSPGQGIDSDDAGELDQDAWLYETCTLALQL
VVDLFVKFYSTVNPLLRKVLMLLVSFIRRPHQSLAGIGIAAFVRLMSNAGDLFSEEKWLE
VVLSLKEAANATLPDFSYIATGVSTVGSHKAIIGQNNGESTGSGTPDDDPERLMTRRLYI
SLSDAKCRAAVQLLLIQAVMEIYNMYRPHLSAKNTLVLFDALHDVASHAHKINTDTTLRA
RLQEFGSMTQMQDPPLLRLENESYQICLTFLQNLTLDRPPSFDEVEVESYLVNLCGEVLE
FYIETSRSGQISQLSSSAQSQWLIPVGSGKRRELAARAPLIVATLQAICSLGDASFEKNL
SHFFPLLSGLISCEHGSNEVQVALSDMLSSTVGPVLLRSC
Download sequence
Identical sequences B9RDE3
30174.m008901 XP_002511732.1.68434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]