SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 36246.m000021 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36246.m000021
Domain Number 1 Region: 106-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000682
Family DsbC/DsbG C-terminal domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 32-91
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.000000000471
Family DsbC/DsbG N-terminal domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36246.m000021
Sequence length 166
Comment Thiol:disulfide interchange protein dsbC precursor, putative
Sequence
MPRRFLKRLSVAAALVGAMCSGLAVAADAPEAVIKTTLEAARPDAKVQSVVRSEMPGLYT
VKFVNGPQVYATPDGKYFVLGDLYQVEQKGFVNLAEQKRNGERAKLLADLKPEDMIIFKP
KGETKAAITVFTDVDCGYCRKLHKEVPQLNAMGIEVRYLAYPRAGI
Download sequence
Identical sequences B9TNE5
36246.m000021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]