SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 42488.m000015 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  42488.m000015
Domain Number - Region: 8-71
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0523
Family MesJ substrate recognition domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 42488.m000015
Sequence length 100
Comment conserved hypothetical protein
Sequence
MIGFDLGVLPAEVDLLESYLNRANQDPEWVQYVRTTLQNTPPPYFDRAFRSFLEIEMCSL
TKEQIERVSDRATPLSGVLPTAFAGNYGATAAGSAVSGNA
Download sequence
Identical sequences B9TB19
42488.m000015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]