SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73538835|ref|YP_299202.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73538835|ref|YP_299202.1|
Domain Number 1 Region: 142-567
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 6.41e-124
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000000999
Further Details:      
 
Domain Number 2 Region: 16-141
Classification Level Classification E-value
Superfamily Cytochrome c 9.03e-23
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.0000964
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73538835|ref|YP_299202.1|
Sequence length 567
Comment hydroxylamine reductase [Ralstonia eutropha JMP134]
Sequence
MTAFPNSLKNSTMKAKSWRFTALAALPLTLWLSHASADTPAAASATPPMAATPTLTPTEF
DHARQIYFERCAGCHGVLRKGATGKPLTPDITRARGSEYLKTFIKYGSPAGMPNWGTSGD
LSDSEVDLMARYIQLDPPTPPEFSLADIEKSRKDIVPVAKRPARKMNQYNLDNLFSVTLR
DAGEVALIDGDSKKIINIVKTGYAVHISRMSASGRYLYVIGRDARLDLIDLWLPKPDIVA
EVKIGLEARSVETSKYKGYEDKYAVAGSYWPPQYVIMEGDTLKPLKVVSTRGMTVDNEYH
PEPRVASIVASHFHPEFVINAKETGKIMMVNYADLNNLKTTTIDSAKFLHDGGFDATGRY
FLVAANASNKIAVVDTKEDKLAALVDVGKTPHPGRGANFVHPKFGPVWATSHLGDETISL
IGTDPVGHKAQAWKVVQTVKGQGGGSLFIKTHPKSTNLWVDTPLNPDAKLNQSVAVFDTR
NLEAGFQVLPVAEWANLKGEGAKRVVQAEYNKAGDEVWFSVWGTKDGESALVVVDDKTRK
LKTVIKDPRLITPTGKFNAYNTQHDIY
Download sequence
Identical sequences Q46R76
264198.Reut_B5010 gi|73538835|ref|YP_299202.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]