SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73538843|ref|YP_299210.1| from Ralstonia eutropha JMP134

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73538843|ref|YP_299210.1|
Domain Number 1 Region: 110-496
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.22e-81
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0000338
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily Cytochrome c 3.73e-20
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73538843|ref|YP_299210.1|
Sequence length 503
Comment nitrite reductase (NO-forming) [Ralstonia eutropha JMP134]
Sequence
MNRFLQWLAACVLAGLCQTAAIGGQAATVDAAALYGQHCAACHGADRLGAMGPALLPESL
ERLRPAELATVLREGRAATQMPGFAGQLDDAKLTDLAAWLRTGPATSRPWAAADIRVSHI
VYPATDSLPATPVFKADPANLFLVVEAGSHHISVLDGDRLEPIHRFRTRFALHGGPKFSQ
DGRYVFMASRDGWVSKYDLWNLTFTAEIRVGLNTRNVAVSDDGKWVLAGNTLPQTLVLLR
ADDLALASVIDVKGRNGRASRVSAVYDAAPRHSFIVALKDIPEVWEIPYVSMKAGTAPAT
RMIALDDVLDDFYFDQSYRHILGASRDGGGQVVDLAHGRKVAALALSGMPHLGSGITWVR
DGHEVMASPNLKQGSISVIDMQSWQTVATVPTNGPGFFLRSHENTPYAWADAMMSPKRDT
LQLIDKQTLAVAGSVTPSPGRTAAHVEFTRDGRYALVSVMERDGAIVVYDARTVREVKRI
PMDKPIGKYNVFNKTTRSSGTSH
Download sequence
Identical sequences Q46R68
WP_011301132.1.84135 gi|73538843|ref|YP_299210.1| 264198.Reut_B5018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]